GenomeNet

>rno:314265 K19027 zinc finger FYVE domain-containing protein 26 | (RefSeq) Zfyve26; zinc finger FYVE-type containing 26 (A)
MSYPFGKEETTTEKQLFEFFCECLRRGDWELAQACVPQLQRGQGEIPQKVEDILQALVQC
PILLRCGPDINPQRLAWLWLLVLEKWLPPEKKLLSTVFRRKLEFLFLSEDLQGGIPETIL
KELFETLAQGPAGCTSDRSQRWESGAPQLSPEAVSMLWNLLKQAPGPAQALLELLLEERH
SASLCHSSLQKSLLDLIRKALQTLRDPASQPAGVTDAVCGALQALCCTAELPEGEWHVLC
EELLETCRTEGSPLKEERLLGCLLHKAGRSLLSLYGHTYAEKVAERPPKASLSGKDHPDP
ERAMLALFSTPDPAHAWKMAFFYCLSNNKHFLEQILVTALTLLKEEDFPSLGYLLDREFR
PLSHLLVLLGWTHCQSLESAKRLLQTLYRNQDQGHDELLRDACEGLWAHLEVLEWCVQQS
SSLIPKRELLCHLHGGDSHSVLYSLHHLTNLPALREEEVLKLLQKVPTKDLQGEHDTHDA
SVPEHLSQCQSLTLYQGFCAMKYAVYALCVNSHQHSQCPDCRDSASSEELALVEPGRDSL
PSPGASHLFPTYLARCRQYLQRIPDSLCLEILENIFSLLLITSADLHPEPHLPEDYAEDD
DIEGKGPWGLWSPSESPQHIAATERRSERASMGPRDLAPTGPGCPKGEPKDNSPGPHTHS
FLDLKHFTSSLSGFLADEFAIGAFLSLIQEQLNELSSHRTPEETELLEDQSCWAARDGLQ
GRLHRFSKVLSEAQWRYKVVTSNQSSEEQPSRRYRPTAKRHSSLRRGRRTRRTRADGRER
GSNPSLEGTSSELSTSTSEGSLSAVSGQVEADNRFQPQPQSSIIPMMFSPPESLLASCIL
RGNFAEAHQVVLMFNLKSSPSAGELMFVERYQEVIQELARVEHKIENQNSDGGNNTVRRT
GSGRSTLQAIGSAAAAGMVFYSISDVTDKLLSPSEDPIPTLQEDFWINAALTETNTPLRG
VLEDLSPPAMAAFDLACCQCQLWKTCKQLLETAERRLSSSLEGRGRRLDQVVLNPDGMRG
FPFVLQQISKILSYPLTVTGLTKSETLEERGGGAPRCSISELLQMCWPSLTEDCIASHTS
LSQQLDQALQSLREALTLSEPKSTPLTCLVEQAAQKAPEAEAHPVHIQSQLLQKTLGKQT
LAGPRQTDYVGAFFSYCSSLAKVLLRSLSSDPDNVEVKVGNPFVLLQQSSSQLVSHLLLE
RQVPPDRLAALLAQEHLNLSVPQVIVSCCCEPLTLCLSRQSQQASSLTAHLGMLAQGHAS
HLLDGLPLSVLGSPRPSENPSAERKSDSSPKDSLPAFTASALAFLKSRSKILAMVACLRA
SRGTKVSRPSLSWKELRGRREAPLTAEKVAQECEHLLEQFPVFEAALLANWEPLQQASES
RPSLAASLCGQARLSTVLLGLHSTLAQDVVTEAFEEALVARDWPRALQLIDVYGQDSDDL
SSVRDSVLTCATVCDKEGWQYLFPVKDASLRSQLALRFVDKWPLESCLEILAYCVSDMAV
PEELKSELQRKLTELRVYQKILGLQDPPVWCDWQTLRSCCAEDPSTVMDMMLGSQEYELC
EEWGCLYPIPREHLVSLHHKHLLYLLERREYEKALQLLQRIPDPTMCLEVTERSLDQHPS
LATSHFLANYLTSHFYGELTTDRHHEIQALYMGSKVLLTLPEQHRASYAHLSSSPLLMLE
QLLMNMKVDWATTAVQTLQQLLAGQDIGFTLDEVDSLLSRYAGKALDLPYPLREKRSDSM
IHLQEPVHQASDPETLSRSSSAEFSAAAAAPAPAAPGSALVCSPSPKERAFPQTQPPLEF
VPPETPPARDQWVPDETESMCMVCCREHFTMFNRRHHCRRCGRLVCGSCSTKKMVVEGCR
ENPTRVCDQCYSYYNKDAPEESPCQSEVPDSAKNESPSYSAVVRIPKATEVEWILSLNEE
ENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSRGLTNPEVDAGLLID
IMKQLLFSAKMMFVKAGQSQDLALCDSYISKVDVLHILVAAAYRHMPSLDQILQPASVTR
LRNQLLEAEYYQLGVEVSTKTGLDSTGAWHAWGMACLKAGNLTAAREKFSRCLKPPLDLN
QLSHGSRLVQDVVEYLESTVRPLVSLQDDDYFATLRELEATLRTQSLFLEAIPDGKIMNN
TYYQECLFYLHNYSTNLAIISFYMRHNCLREALLHLLNKESPAEVFIEGIFQPSYKSGKL
HTLENLLESIDPTLESWGAYLIAACQHLQKKNYYHILYELQQFMKDQVRAAMTCIRFFSH
KAKSYTELGEKLSWLLKAKDHLKIYLQENSRSSGRKKTTFFRKKMAAADVSRHMNTLQLQ
MEVTRFLHRCESARTSQITTLPLPTLFGNNHMKMEVACQVMLGGKNVEDGFGIAFRVLQD
FQLDAAVTYCRAARQLVEKEKYGEIRQLLKCVSESGMAAKSDGDTILLNCLEAFKRIPPQ
ELEGLIQAIHSDDNKVRAYLTCCKLRSAYLIAVKQEHTQAAALVQQVQQAAKSSGDSVVQ
DICAQWLLTSHSRGAHGSGSRK

BLAST