GenomeNet

>rno:317241 K16271 E3 ubiquitin-protein ligase RLIM [EC:2.3.2.27] | (RefSeq) Rlim, Rnf12; ring finger protein, LIM domain interacting (A)
MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTE
EELLRRLQQIKEGPPPQSSDENRAGESSDDVSNSDSIIDWLNSVRQSGNTTRSGQRGNQS
WRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENENEPSTRRLSVESMESSSQRQMESHAS
ESTSARPSRAERNSTEALEVPLTRGQRRARSRSPEHRRTRARAERSRSPLHPTIEIPRRA
HHNISPQTLEQPLENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSD
TGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTPNNTVTYESERGG
FRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYS
DSDSEPSASVSSRNTERAESRNGRGSSGAGNSSASSSSPSPSSNGESSESSSDLFEGTSE
GGPSGPSRRDGRHRAPVAFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQIDNLAMRSF
GENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRE
SVV

BLAST