GenomeNet

>rno:364403 K08890 B lymphoid tyrosine kinase [EC:2.7.10.2] | (RefSeq) Blk; BLK proto-oncogene, Src family tyrosine kinase (A)
MGLLSSKRQISEKSKSWSPVKARAQGKVPPPLPPLVVFNHLPPPSPNQHPDEEERFVVAL
FDYAAVNDRDLQVLKGEKLQVLKSTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDVTSQGEMVKHYKIRSLDNGG
YYISPRITFPTLQALVQHYSEKGDGLCQKLTLPCVNPAPKNPWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTRE
PIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANI
LVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYHDVITECWRGRPEERPTFEFL
QSVLEDFYTATEGQYELQP

BLAST