GenomeNet

>rno:404938 K04257 olfactory receptor | (RefSeq) Olr954; olfactory receptor 954 (A)
MKNNTITTFLLLGLTDDPQLQIPIFVFLFVAYMLSITGNLTIIALTILDCHLKKPMYFFL
KNFSMLEISFTSACIPQYLYNIATGDRSITYDVCVTQVFFIDVFGVNEFFLLAIMSYDRY
VAICKPLHYVTIMNSKVCQTLNLCCWMAGLLIILPPLTLLLNLKFCDSNVIDYFFCDASP
ILKISCSDTWLIEQLVIVCAVLTFILTLVCVTLSYVHIIKTILRFPSAQQRKKAFSTCSS
HMIVVSITYGSCIFIYINPSAKESVAINKGVAVLMSSIAPMLNPFIYTLRNKQVREAFSD
SIKKITMISMKKENVQI

BLAST