GenomeNet

>rno:499971 no KO assigned | (RefSeq) Iqca1l, Iqca1p1; IQ motif containing with AAA domain 1 like (A)
MSEGTYQRLWEASHATLEEVLEKEPSPLEPVLTRERQSFQYRISVLYLYYLGLLRRFNLA
YDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQELKLTPADLEVPI
PKYFQLEQTSTMKARQQMLAEILARLEPLASQENLRGMSRTEALIIVQCAERARQGRLRA
TFMREIRKEEERDRRIRENGRQKFSQDQGAIVIQKVWKGYLQRKRIEQDRRMEMEFIGML
PSSSQTTRQNALAQAFVGEESRRTRQVEKEEEFQEAIAKTHESLTETEGPDMKERMKDQI
RQWFIECHALTGRFPDYPDEASGGSYLIFADKTPEQVRQELEAQAQENKKKEQEKNKDKV
KEKKEKKKKKTKEEKAKKDPEVMFKVLPSKSIPVINAGHEEFTSIWKSRYDNKHPSQSFD
SETLREEKRKQVEMEIRVQVDELMRQELRNLRLAVDREETRPLKSPKKKGGKKSGKKKKE
KDLTPDRSVDSLFEELVVIGLIKKSLLVTLNDYIGDCLYLGSTLTLANKIPMPSLFDIRQ
NIALYGVLRLGSHDIHTMAPLVRSILLVGPSGMGKKMLVQAVCTETGANLFDLSPGNVMG
KYPGKNGSQLLMHIVFKVARVFQPSVIWIGNTEKTFYKKIPKEERRMDPKRIKKDLMRAT
RQLGPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVLWKRMIENQGIGVQ
QTQSLDISALARVSDGYTPGHILQSIQSVLTERRLLQLTKKPLVASEFVVHLAKLDPVYR
EEEESLKEWFYKTPLGKKNIKFTKDQQEAEEARLAKEKKKKK

BLAST