GenomeNet

>rno:58949 K04279 platelet-activating factor receptor | (RefSeq) Ptafr; platelet-activating factor receptor (A)
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT
VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY
SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV
FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN

BLAST