GenomeNet

>rno:681236 K06506 CD79A antigen | (RefSeq) Cd79al, Cd79a; Cd79a molecule-like (A)
MLGGLGVLRTLPLLLLFLSEACLGPGCQALMLERDPPSLTVNLGEEAVLTCKNDGKNPNI
TWWFSLQSNSTWPPMPLGPGLGPMGKLIFPEVNKSHRGLYWCQVIESKEVKRSCGTYLRV
RSE

BLAST