GenomeNet

>rno:85274 K03386 peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15] | (RefSeq) Prdx4; peroxiredoxin 4 (A)
METWSKLLDGTTPSRRWRKLVLLLPPLLLFLLQTEALQGLESDDRFRTRENECHFYAGGQ
VYPGEVSRVSVADHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPL
DFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLS
DLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYT
DKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

BLAST