GenomeNet

>rpc:RPC_1570 K00605 aminomethyltransferase [EC:2.1.2.10] | (GenBank) glycine cleavage system T protein (A)
MMLAQNDQTAPLQRTPLHALHLSLGGKMVPFAGYEMPVQYPTGVLKEHLHTRAKAGLFDV
SHMGQLELRAKSGHVADAARALERLVPQDILAIAPGRQRYAQFTNEQGGILDDLMVANSG
RHLFLVVNAACKAADEAHLRDGLSDVCDIVSRPDRALLALQGPHAEAALSRLCSQVDTLR
FMDTAPLTVMGLDCLVSRSGYTGEDGYEISVPADGAVALAEALLDDPEVLPIGLGARDSL
RLEAGLCLYGHDIDASTTPVEAALEWSIQKSRRNGGPRPGGFAGAAVILDQLETGAPRRR
VGLRPDGRAPVREGAPLFGDDSATDSIGTISSGGFGPSLGGPLAMGYLPTPQARHDAVIF
AELRGQRLPLRVCATPFIPTSYKR

BLAST