GenomeNet

>rsi:Runsl_5207 no KO assigned | (GenBank) Forkhead-associated protein (A)
MEITCKKCKSRLKIINTGSPIVKCGNCGYPNPVVISPPKAGETNAPPAPATAKVAPPPSP
FPPPNPNPRPFVGGGLPHTPGAAPKSEPGWLVVHDENAPEQTHSLRVGRQVIGRLNTTAP
CDIMITTQDVYMSRNHCILEVKPGRTGGFDYLLSDRKMTNGAPELMSANGTYVNAFEKPL
QPNDMVYLNDGDTIQIGQTKVVIKTIKTVANADDATRLVRDTDYTPTVIIKN

BLAST