GenomeNet

>rso:RSp1438 K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (GenBank) probable trna synthetase protein (A)
MTRYIVTITPPTPNGDLHLGHLSGPFLAADICRRLLRQAGEDTILLSYSDDYQSYMPRKA
RQLRKETFGLARYNARQIELAMQAAEIDIDCFLQAADSDTFARFAGERFDDIGRLGLLEL
KATPVFRCDACAVYGYEGLGRGHCNWCGASSDASQCEACARVPDVAHMQGMHCILCGGDM
HRVPVTRYVWKIGAQYPAIAEALKALPKRAALETYLADVLRNTSDAWPVTRPGDAGLELD
GYPDQPVNTWFMGLAGYQAALADYLAAHPERGAFDDWWTPDTQLVHFLGYDCSYSHAVGY
TAQLLARPDGPRPGVYLTNQFLKLDGQDFSTSRGHAVWIREITAQHPVDAIRLYTALCAP
ENETRDFDRAAFEAWRKAIFDGIVAAYTRDLSAGAAPSAAALPAQLEQRIAGIRGQWARA
ASLGAFSIAGLAKAALDMAQLTMTECEPGQRHLGWRIFSEMVASVAPSTAAEIDALMAAH
GPNRAAPTPEVEIAGV

BLAST