GenomeNet

>salp:111969532 K00622 arylamine N-acetyltransferase [EC:2.3.1.5] | (RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like (A)
MNLEEYFKKIGFHGPFSKPDLETLNQVHKHHVMSIPFENLSIHCGEKITMDHELIFNKIV
RSNXGGWCCENNLLFAWVLKEIGYNPVTLGSRVYNNTINQFGPKDSHLINKVVIDGTAYI
ADVSFGVSSQIWHPLELVSRKDQPQSPGVFRLIQDGDLWTLEKTGQKPLVLNEAFTNSPL
VDKSPTTKIYGFTQVPRGVDNFLETSHCLQTDPKSLFTNKSICSMQTATGFRALIGWTFS
EVTYNNQDGFDVLDMKDISDDDVDKVLKEMFNVLLANKLVPINNKAGYTI

BLAST