GenomeNet

>sau:SA1599 K00616 transaldolase [EC:2.2.1.2] | (GenBank) ORFID:SA1599; hypothetical protein, similar to transaldolase (A)
MAKLNVEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDAS
ISFEVFADDLETMEKEAAILKQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAV
YTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMKEAVKVTHSKDGVKLLWASCR
ELFNVIQADEIGADIITRPADVVKKVNTNLGRDINELSVDTVKGFAKDIQSSGLSIL

BLAST