GenomeNet

>sbb:Sbal175_2055 K11896 type VI secretion system protein ImpG | (GenBank) type VI secretion protein, VC_A0110 family (A)
MNDELLKYYNRELTFIRRMGAEFAEQYPKIAGRLRISEENVEDPHVSRLIEGFSLLTAQI
RQKLDDSFPEVTDALLGQLYPDYQAPIPACSILKLTSQNLSTSGVLVARGTEFETKTEGL
KNCLFQSCYDTEVLPLEVTKAEFKNAPFNAPTPNLKQPIKALVKLTLTCEFDTTEMHELG
VTRLRFYLNGQRHHVYPLYELLHRQVISIGVSASDEASIRYLQPRHIQQVGFGDNESVVP
YSQKSFSGYRLLIEQFLCPEKFLFIDLIDLDPNWHGIKDEFNLYFYLSEGAAELERHINA
DSFLLGCTPVINLFQQKLEPIKLVSSQYEYRLAASYLDADVCEIISIQDIRAYDPFGNEM
VLNPYYSQGHPAFSQQQNMFWHSRREFVNWAGGYSEAGTEVYLSIIDCQFKGMAIDGAEQ
DWVIQVNALCSNRNLPSYLPFGGGEPHFSIRSHVDIIKDVRCLIAPTSPVRPALKENTRW
QLVNHLTLMSFSGENALSQLQETLKLYDFRGAPESRSLIDGITAVTISNGTARVNQQGRV
AVCAGSDILIEFSQSSYAGTGVYFFAGILDIFFSQFAAINSYTRLSIKLRDQAQIYHTWP
ARVGTQVLL

BLAST