GenomeNet

>sbm:Shew185_4436 K12057 conjugal transfer pilus assembly protein TraF | (GenBank) Type-F conjugative transfer system pilin assembly protein TraF (A)
MRTLLNDRLQHAAVSPFFRWSSHAPLAWLSTKKGDAVVNKRSALVLLMLTTFCLGANATD
AQGWRWYNEPTAPKKQALKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQD
SKKVERAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKM
RAVRSLADAGWGLFFVYKGQEEIDIALAPSVQQFATEHGIELLGVTLDGVALPAIVQNRQ
NDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFLNVATDFAPDF

BLAST