GenomeNet

>ses:SARI_04667 K03581 exodeoxyribonuclease V alpha subunit [EC:3.1.11.5] | (GenBank) hypothetical protein (A)
MTIQKRLLEAVEQKLLRPIDAQFALTVAGNDEPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGGGAQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSVIRAVFQQGYSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRVEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFAMPDGAIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPNQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
STLFDEVSHIG

BLAST