GenomeNet

>sezo:SeseC_00065 K02890 large subunit ribosomal protein L22 | (GenBank) rplV; 50S ribosomal protein L22 (A)
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKHTTHVTVVVSEK

BLAST