GenomeNet

>shg:Sph21_4842 no KO assigned | (GenBank) hypothetical protein (A)
MFNYEIGGNERKIDASEAFADIAHNKTLFVQKLTDSDPIKPEKVEGLKTVQDVFNHYEPQ
VQVEFENQDGTLIPETLRFANLGDFAAQSMIKQSRHLNNVQIEKEMSISVLKQLKSNRTL
QTTLANEETKNAFVNALKSFIRELEEND

BLAST