GenomeNet

>shr:100919294 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) HK3; LOW QUALITY PROTEIN: hexokinase-3 (A)
MNENTLESVQQCLNQFDVTEEQLQQIQAGILGDMERALGRQAGSSPSVQMLPTYVRSTPR
GTEQGDFLVLELGASGATLRVLWVTLTGISGPRKEPVSQEFTIPTEITLGTGQQLFDFAA
GCLVQFLDQLQVGSQPIQLGFNFSFPCHQTGLNQSTLISWTKGFRCSGVEGQDVVQLLRE
AIQRQGAYNIEVVAVVNDTVGAMMSCDPSPQACEVGLVVDTGTNACYMEEVRHVAELKED
RGRICVNVQWGSFGDGGALEPVQTPFDLQLDQESLHPGTQRFEKMVGGLYLGELVRLVLI
HLAGQGALFGGVTSPALLTHGSVHVQHVMEIEDPSHGRAPGQAMLQELGLTPSAQDCAQV
QRVCGAVSSRAARLCAAALTAVLARVRSNXGEIPTGRLCGYTGGRLYKQHPRFSALLQQT
VRLLAPDADVTFVPSEDGGGRGVAVVTAVASRLALQRRQLEETLAPFRLHSQQLKAVQAQ
MRESMVRGLRGESSSIRMLPTYVCAMPDGTERGDFLALDLGGTNFRVLWVKVGSRSEEGI
KIINRVFSLPESVTQGTGQQLFDHIVDCIVDFQKENNLSGQTLPLSFTFSFPCKQLGLDQ
GILLNWTKGFKASDCEGQDVVSLLRAAIRRRQGVELNVVAIVNDTVGTMMSCGYEDPHCE
VGLIVGTGTNACYMEELGNVCAVPGDRGRMCINMEWGAFGDDGLALQEFYTPFDLSVDQA
SINPGKQRYEKLISGMYLGEIVRQVLLHLTHLRVLFGGQEFPSLQTKDIIKTKFLSEIES
DLERWQVRAILEKLDLQADCEDALLVREVCQAVSRRAAQLCGAGVAAVVEKIRENRGLDR
LSVTVGVDGTLYKLHPHFSEQVKDAVRELAPQCCVRFLLSEDGSGKGAALVSAVACRLAG
AAGP

BLAST