GenomeNet

>slal:111652225 no KO assigned | (RefSeq) fancd2; Fanconi anemia group D2 protein (A)
MMRKKRRSSVDKGEGATSTTKAKKSRSTGRQRKEAAPEETNESVFSVFLREAGVTLKKGG
TSNEIAVDQVVFQKRIQQQLRKSPRYPGIVQEFITGLESHIEDHERFRNCLLPCVPQLPD
GDARSVSSFQESLLRMLLGIEMLQTPIINTLLEKLPEFMLDGTGDGGLSIPRIIINQLKW
LDRVVDSKELASKLMELVSVAPVDVQRDIITSLPEILEDSQHNDIARELNILLQTDTQLT
VPVLDALSSLNLSSSLLTEVRGAVMATLAAVQLEDLPVVVKFILHSVSASDAYEVVNNLR
KKLELEQCVLPPVLQASQSRMKSKGGAVSASTPAAGSSVTLILDGIKSAVRFQKSISEAW
VKAIESVDEAENHKVIDLLVLFILHSTNANQSRRGAEKVLKAKVRTGLIQDTLLQRTFRD
YSQVMRGYFPSILALAQSLLRSPDPGVVPFGGHMYQLSFTVFESYCQQVGCPLILTDMDV
IEKIESLSKAEREFLCNLLFHTINWFREVVNAFCRQKETELKMKVMTRLQNITYVQTLLE
RALAGTPGYVPPVANFDGESTDGLILSSAAPVNKAKKDGTGKKRKAPSKSSSEGSSQLDE
TTEADETLQEQPEKEKEKEVRQGVSLMSYRQFFRELDMEVLSVLQCGLLSRSLLDSELHS
KVQEEVMLGPAELVFLLEDMLRKVEFSLRAAPAKRAPFLKGRTDKSVGFSHLQQRSSKDI
ASYCVQLLPALCSHLEDCHNHFQTLLSENNGVVDGPATDVQEHQLMSYSYQLLLQILNTT
FCWSGFSLPGQRSLLKKALGVLAERLKEQRPDLTLEQLVKHSFEYLLNFRSTMPSLSTAL
CLSQLLSTVSAKGGNSATYREQAASLAKRFLSQEWVTASGEKERGNKFNEALQTLLSIYL
EHVDDVLKAVEEIAGEGIPELLNASKDESSASWPTLNRQTFLVFYKVMMAELEKAIRKIP
AGKISDNSEAQSEKLLTWNLAVRDFHILVNLVKVFDSRPVLNVCLKYGRLFLESFLKLGM
PLLDYSFKRHKEDVQSLLKTFQLSTRQLHHMCGHSKIQQDTSLTNHVPALKKSLELFLYR
VKAMLMLNNCQEAFWMGNLKNRNLKGEEILSQRSSDDEEEEEQHSLLPQEQSEDEAQESD
SEESKKINIEEDVDPDDITDDSDD

BLAST