GenomeNet

>sma:SAVERM_2373 K05553 minimal PKS acyl carrier protein | (GenBank) pks9-1; putative acyl carrier protein (A)
MATFTQADLVGYIRQAAGEDEGFDLDGDIADITFADMGYDSVAMVEVTLLVERELGIGLP
DDDKASKNSTPKQFVELVNELLPASI

BLAST