GenomeNet

>sma:SAVERM_2945 K10979 DNA end-binding protein Ku | (GenBank) ku1; putative Ku70/Ku80 protein (A)
MLHVRSIWNGAISFGLVSIPIKLVNATESHSISFRQIHLEDGGRIRYRKFCELEDREVTQ
DEIGKGYEDADGTIIPITDEDLAQLPIPTARTIEIVAFVPADRIDPLQMDTPYYLSANGV
PAAKPYTLLREALKRSQKVAVAKFALRGRERLGMLRVVEDVIAMHGLLWPDEIRPPESVA
PDASVTVRDKELDLADALMDTLGEVDLNELHDGYREAVEALIEAKASGEKVPSAPADEPG
GKVLDLMAALEKSVRAAKESRGEGTGSETGSETRDRTGAKKGKATGKDTGKEAQAEVTRL
RRKTARAAPKEVGGKKSTSTAKKATAKKAAPKKTTAKKTTAKATSAKKTTAKKTPAKKAT
PRKRSA

BLAST