GenomeNet

>sma:SAVERM_2946 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; putative DNA ligase (A)
MTPITEVAGRRLALSNLEKVIYPATGFTKGEVLHYYATTADALLAHLHDRPISFLRYPDG
PDGQVFFAKNVPPGTPDWVVTAEVPRSEGPARMVLVQDLASLMWAANLVTEFHTHQWRIG
TPGQADRLVFDLDPGPPATIVECCEVALWLRERLAADGIESYAKTSGSKGLHLLAALEPT
PSGRATEYAKELAVAAEKDMPRLVLHRMTRSLRPGKVFVDWSQNAARKTTAAPYTLRARA
EPTVSTPVTWEEVADCTAARPLAFQAPDIAPRLQEHGDLLAPLLDPGHAAPLP

BLAST