GenomeNet

>sma:SAVERM_6872 K03060 DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] | (GenBank) rpoZ; RNA polymerase omega subunit (A)
MSSSITAPEGIINPPIDELLEATDSKYSLVIYAAKRARQINAYYSQLGEGLLEYVGPLVD
THVHEKPLSIALREINAGLLTSEPVEGPAQ

BLAST