GenomeNet

>spav:Spa2297_29070 K07008 gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118] | (GenBank) ergothioneine biosynthesis protein EgtC (A)
MCRHLAYLGPSEPLGRLLVAPPHGLYRQSWAPRRQRHGTVNADGFGVGWYAGDDPVPARY
RRAGPIWADQSFADLARVVRSGAFLAAVRDATLAGADAEAAAAPFAAGARLFSHNGAVTG
WPGSLAGPAGTLPPEELLSLEARNDSALVWALVLARLRAGDDDGRALAETVLEVAAAAPG
SRLNLLLTDGATVTATTWGDTLWYLTLPGGGTVVASEPYDDDPRWREVPDRTLLVADRAE
VRLTPLKEPGDTATQAFVSPKEPRT

BLAST