GenomeNet

>spk:MGAS9429_Spy1509 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) gatA; aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A (A)
MSFNHKTIEELHDLLVAKEISATELTQKTLEDIKSREEAVGSFITVSEEAALKQAAAIDA
KGIDADNLMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDATSVANAYAKDMIVIGKT
NMDEFAMGGSTETSYFKKTKNAWDHTKVPGGSSGGSATAVASGQVRLSLGSDTGGSIRQP
AAFNGVVGLKPTYGTVSRYGLIAFGSSLDQIGPFAPTVKENAQLLNVIASSDVKDATSAP
VRIADYTSKIGRDIKGMKIAFPKEYLGEGIDPKIKETVLAAAKQFEALGATVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRADDAKNLDEIYVNTRSQGFGDEVKRRIMLG
TFSLSSGYYDAYFKKAGQVRTLIIEDFDKVFADYDLILGPTTPAVAFGLDTLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFVDGLPVGLQLIGPKYAEETIYQAAAAFEAVTDYHKQQ
PIIFGGDK

BLAST