GenomeNet

>spop:SporoP37_02545 K00240 succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4] | (GenBank) succinate dehydrogenase iron-sulfur subunit (A)
MSEQQTATAQKTVVFDIERQDTATSKPYTERFEIPYRPNMNVISALMEIRRNPVNAKGEK
TTPVNWDMNCLEEVCGACSMVINGRPRQSCTALVDQLTQPIKLQPMRTFPVVRDLVVDRE
FMFDSLKRIKAWVPIDGTYDLGEGPRMPERKRQWAYELSKCMTCGVCLEACPNVNDKTNF
MGPALMSQVRLFNAHPTGSMNKDERLATVMGDGGITECGNAQNCVVACPKGIPLTTSLGA
VGRATTIQMFKNFFGSDHQVD

BLAST