GenomeNet

>srl:SOD_c35470 K00940 nucleoside-diphosphate kinase [EC:2.7.4.6] | (GenBank) ndk; nucleoside diphosphate kinase Ndk (A)
MTVERTFSIIKPNAVANNDIGAIYARFERAGFKIIASKMLRLTREQAEGFYAEHKGRPFF
DGLVEFMTSGPIVVQVLEAENAVQRNRDIMGATNPDNALAGTLRADYADSFTANAVHGSD
AVESAQREIAYFFNESEICPR

BLAST