GenomeNet

>srx:107746831 K10180 T-box protein 6 | (RefSeq) T-box transcription factor TBX6L-like (A)
MVMYLPEERPVLDLPYQMNYLANNYGYYPQDCKEPIFRTQHGLNSRMNSPEAELTSLPVH
VSLQDRELWDKFSSMGTEMLITKSGRRMFPSCKVTVTGLNPKVKYVVIMDMVPFDNHKYK
WNKDRWEVNGSTDPHLPNRFFIHPDSPAPGEKWMQYPISFHKLKLTNNTLNSNGLVVVHS
MHKYQPRLHIVQSPDPCNPHNSGGYLRFTFPEAAFKAVTAYQNQEITKLKIDNNPFAKGF
RDNGLNRKRFREKESQETPDSVGQAKQDLTSNDHVGQPQKDEEVDVTVSSSVDCRRTLNS
SEVASSVTPNPFISAFINPSTAGGPSPHQTHTILSLSNRHLNSPREARPSSLHSLCAALP
VAQSFCVQSSTGDTNLSSPLNPQQHHHHCSPASQTPGRSIIQLQPYFQTPPHPSRQCPDM
ELPLPLPPKLSRMQLPESALRNLEMTPGSDYANLRPLTDILNRIHFRALASGPSGKVLQN
PPQPEQYLRGSDRELRPQIYPALQEYIDQQFTLNSMLSSQTEHRSQMDYVSARPQTEYYC
EQQPGK

BLAST