GenomeNet

>ssc:100516610 K01874 methionyl-tRNA synthetase [EC:6.1.1.10] | (RefSeq) MARS; methionine--tRNA ligase, cytoplasmic isoform X1 (A)
MMGEIVYFRNPGPGNSFSRNSISRRAARQSLIPLAGDRFRLHQRGTHGEMRLFVSEGAPG
SLPVLAAAGRAQGRVELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLFSASAICRYFFL
LSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGPVRRALTHIDHSLSRR
SCPFLAGETESLADIVLWGALYPLLQDPAYLPEELGTLHSWFQTLSSQEPCQRAVETVLK
QQGVLALRPYLQKQPQPSFLEGRAVSNEPEEEELATLSEEEIAMAVAAWEKGLGSLPPLR
PQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRLRQWNTLYLCGT
DEYGTATETKAMEEGLTPQEICDKYHAVHADIYRWFNISFDIFGRTTTPQQTKITQDIFQ
RLFTRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAIELK
KPQCKVCRSCPVVKSSRHLFLDLPKLEKRLEEWLEKTLPGSDWTPNARFIIRSWLRDGLK
PRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVSLYQF
MAKDNVPFHGLVFPCSALGTEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQNTG
IPADIWRFYLLYIRPEGQDTAFSWTDMLLKNNSELLNNLGNFINRAGMFVSKFFGCFVPE
MVLTSDDRRLLAHVTLELQHYHQLLEKARIRDALRSILTISRHGNQYIQVNEPWKRIKGS
EADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLSPPACSILPTNFLCTLPA
GHQIGTVSPLFQKLENDQIESLRQRFGGGQLEESLALKAKVSPKPAVVETVTTAGPQQVQ
VLMDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPFETPKGKKKR

BLAST