GenomeNet

>stt:t4274 no KO assigned | (GenBank) hypothetical protein (A)
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVIST
PGTMYGMKRIGLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSM
PAMILQRANPGLYEMITNGVLQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREE
YKEAVSASGGDALRAEEARTKASGKEGATWVGGKKAGGKGQPAIQPTRDLAKAGYNMMNN
LSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRSIRTCKDATECGSGGIDNAQG
TTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTRGVIDALKRDP
DAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ

BLAST