GenomeNet

>sty:STY4577 no KO assigned | (RefSeq) hypothetical protein (A)
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVIST
PGTMYGMKRIGLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSM
PAMILQRANPGLYEMITNGVLQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREE
YKEAVSASGGDALRAEEARTKASGKEGATWVGGKKAGGKGQPAIQPTRDLAKAGYNMMNN
LSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRSIRTCKDATECGSGGIDNAQG
TTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTRGVIDALKRDP
DAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ

BLAST