GenomeNet

>sya:A6768_23485 K02226 alpha-ribazole phosphatase [EC:3.1.3.73] | (GenBank) histidine phosphatase family protein (A)
MMGMPLHLLRHGAPETPGLLLGRTDSVPTRAGIDACLAQAEGLEIEMIVTSDLQRARQAA
TAIGERAGLPVWVDPRWRELDFGIWDGLAPADVDPEALARFWQDPDGFAPPGSEGWTALL
GRIADAVEDLPRVPTLVLTHGGAMRAALAHLCGFSVQQSWSFGLPYAALLSLERWTGEPP
LARITGLRP

BLAST