GenomeNet

>syc:syc1611_d K01997 branched-chain amino acid transport system permease protein | (GenBank) livH; integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD (A)
MDWLQPLINGLAIGGVYALFALGYTLVFSILGVINFAHGAVFTLGAYLTYALVGGRFSFN
GLLANAALPFSLPFALALLLGSLLAGGASLLIEQVAFRPLRRRQADPLLTLISSLGVAVF
IVNLIQILVGAEIYTFPSNIYGDLPSAINLGSSDRPIQIRTVQIILFVVAIAMFSLLTWL
INGTRVGHALKAVAEDATTASLLGIDPDRYIRLTFFLSGVLGGLAGTLVGTSVSITGPYF
GIAYGLKGLSVMVLGGLGNIPGTIAGGLLLGLAEAWVPPQWSGYRDAVAFALLFAMLLIR
PQGLFSRARTEKV

BLAST