GenomeNet

>syc:syc1642_d K22935 D-ribulokinase [EC:2.7.1.47] | (GenBank) xylB; probable sugar kinase (A)
MVVALGLDFGTSGARAIACDFDSDRSVSVSVTFPKTSQNWPQVWREALWQLLTQIPADWR
SRIERIAIDGTSGTVLLCDREGQPQTEPLLYNQACPIGLADLADWVPADHAALSSTSSLA
KLWFWQQQFGALPPDWQILAQADWLSLQLHGCSQQSDYHNALKLGYSPDRERFSKNLLDS
ELGALLPVVHEPGVAIGPILPAIAQEFGLSPDCQICAGTTDSIAAFLASGAHQPGVAVTS
LGSTIVLKLLSQVAVSDRLTGVYSHKLGGYWLTGGASNCGGATLRQFFPDTELESLSCQI
DPTKKSGLDYYPLPSRGERFPIADPDRLPQLEPRPENPVQFLQGLLEGLAQVETLGYQRL
QDLGATPLKRIWTAGGGAKNAVWQQLRQQAIGVPIAIAPNTEAAFGTARLAAFGLAAFHS
AGLKRT

BLAST