GenomeNet

>syc:syc1726_c K00941 hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7] | (GenBank) thiD; phosphomethylpyrimidine kinase (A)
MAVPIALTIAGSDSGGGAGIQADLRTFAFHQVHGTCAITCVTAQNTLGVTRVDAIAPAGV
AAQLDAVLSDLPPQALKTGMLLNAEIMEVVAGTIAPLFIPRIIDPVMVSRTGAVLIDQAA
IAVLRDHLLPLATVLTPNRYEAQLLAGMDIQDAADLDRAARIIRDLGPQAVLIKGGAATG
DWHGVDWWWDGQRSHILKTEAIATPHTHGSGCTLAAAIAANAALGLEILAAAQAAKHYVT
KALRHSLAIGQGQGPLGHFYPLF

BLAST