GenomeNet

>syc:syc1732_d K19802 L-Ala-D/L-Glu epimerase [EC:5.1.1.20] | (GenBank) hypothetical protein (A)
MQLSFEPFTVHKRFALRISRGSTQATTNLWVRLQQDGLEGWGEASPFSTGQQSQTTELLS
EALTTIAPALVHLDPWNHQQFEDLTRSLPSAARAALDLAIWDWRGKALGQPLWKLWGLAR
DRCPVTSVTIGISSPQAGQERLAAWRELFEPALIKVKLGSPEGVEADRVLLNALKEVAPT
TPFSVDANGGWDVATTRSLADWLVESGVIYLEQPLAKGQEADLLQLRDLPLPVFVDESAW
TSQDVAALSDRVDGINLKLLKTGGLTEALRAIHTARAHGLQLMLGCYSDSSLLNSAAAQL
GPLVDYLDLDSHLNLLDDPFNGATIAAGRLVPSDRPGLGVLRQE

BLAST