GenomeNet

>syc:syc1734_d K00677 UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129] | (GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine o-acyltransferase (A)
MGIHPTAVIDPQAKLGQDVEIGPYAVVQGPVEVGDRCWLGPHSVVMGNLQLGTDCRVHSG
AVLGDWPQDLSFQGAESHVVIGDRNVFREGVTVHRGTKEGSVTTIGNDCLLMANSHVAHN
ASLGNNVILANGALIAGYAQVGDRAFISGNCLVHQFTRVGRLAMMSGGSAVQKDLPPFCM
TRSSTSNIVMGLNVVGLRRAGVSDRDRLELKRAFSILYRERLSFSEAIARLSADFHSPLV
TELQAFVSSSERGICRFLRSDLDA

BLAST