GenomeNet

>syc:syc1747_d no KO assigned | (GenBank) cysR; transcriptional regulator CRP family protein (A)
MRENIMTPVWTRPTLASGQLRQVLEQIYRDRPMLHFTAGQTVPLPQDSIWVVCRGIALIT
TSYESGDEALLGLAGPSMPFGSALSWVMPYEVQALTDLDLIRLKLVEIEQTPLLAQDLFL
MLAQRHRQTEMLLSPIGQRRVEDRLRNFLQLLGREFGQPEDQLLRLNCRLTHQHLANALG
TTRVTVTRLIGQFRREGWLDFDDQRHLVLKGLL

BLAST