GenomeNet

>syc:syc1751_d K05808 putative sigma-54 modulation protein | (GenBank) lrtA; light repressed protein A homolog (A)
MKLVVQGTNIDVTAAIHDYVQQKLDKAVSHYQSFLTEIDVHLSVAKHAKSNPRQTAEVTI
YANGTVIRAEECNENLYASIDLVSDKITRQLKKYKEELRDRKGQLSTAETADQLSDGALV
TDLLNGRQPELPQDIVRTKYFAMPAMTVEDALAQLQLVDHDFYMFRNAATGEINVIYERN
HGGYGVIQPRPEGNSEKAVVVRSEAVL

BLAST