GenomeNet

>syc:syc1752_c K09121 pyridinium-3,5-bisthiocarboxylic acid mononucleotide nickel chelatase [EC:4.99.1.12] | (GenBank) hypothetical protein (A)
MNAVVLRHGPFPRMTQIAYFDCPTGIAGNMCLGALVDAGVPLSYLEQQLQRLSLSEPYQL
VATPVLRQGMAATYVEVQIEAAPHAHRHLSHIVALIEAAGLPDRVRDWSIAVFQQLAIAE
AAVHGVTPEQVHFHEVGATDAIVDIVGTCLGLDYLGIEAVYCSALPTGGGTVKAAHGQLS
VPVPAVLRLWQLRQVPVYSNGIERELVTPTGAAIAVTLAKSFGPPPSLQLQKTGWGAGSH
DLPIPNLLKLWIGTASDLVMTPQSPEGSLETVQVIETQIDDCSPQVLAYVSEQLLAQGAL
EVFSQAITMKKGRLGTLLTIICQPDQQAACETILFRETTTIGLRFRREQRRVLPRRRDRV
QTPWGEVRVKVAGDPQSPLTVQPEYEDCRAIAQAQQIALHHIQTVAQQQWQQENA

BLAST