GenomeNet

>syc:syc1756_d no KO assigned | (GenBank) hypothetical protein (A)
MPIGGRRLVHRQQLEGVTLRQRIQAMSDCNRDPVSQITDLSGALVTIVPSLLACVGMVFA
SNLTDVTAEALLYDYREAANPLGQRLIARVPYQDWGAELHQTPETAIIPLDLSEALGCEG
PATSPSLLANFVHILPNQAIETTAIATSQIFYVLRGQGVTRVADQEIAWTEGCCLALPAD
AIATHYAQTDSAFYWVHDAPLLRYLGVKPDRARFQPTLYRRQDLEATLAAIAADPQSRKA
NRLSVLLANQNFPQTRTITHTIWAMFGLLPPDVVQAPHRHQSVALDLILDCQPGCYTLVG
TQLDERGQIRNPVRVDWRPYSVFVTPPGYWHAHYNESGQEAHLLPIQDAGLHTYLRTLDI
LFARHNGQISDEAA

BLAST