GenomeNet

>syc:syc1760_d K02696 photosystem I subunit VIII | (GenBank) psaI; photosystem I reaction center subunit VIII (A)
MSGDFAAAFLPTIFVPLVGLGLPAVLMSLLFTYIESEA

BLAST