GenomeNet

>syc:syc1763_c K03977 GTPase | (GenBank) GTP-binding protein engA (A)
MPLPIVAILGRPNVGKSTLVNRLAGSREAIVHDEPGVTRDRTYQEAFWCDRDFTVVDTGG
LVFDDDTEFLPLIREQAELALAEAALAVLVVDGQAGLTAADNEIADWLRHQNRPIVVAVN
KCESPDKGAAQAAEFWSLGFGEPLPISSIHGSGTGELLDRVLELLPPADEAAGDETEIGV
AIVGRPNVGKSSLLNSFLGEQRAIVSPIAGTTRDAIDTVIERNDQRYRLVDTAGIRRKRG
VDYGPEFFGINRSFKAIRRADVCLLVIDVLDGVTDQDQKLAGRIEEDGRACVIVVNKWDA
HEKDSSTIYEVERQLRDRLYFLDWAPMIFVSALTGQRVEKILDQVNTVVEQHRRRVGTSV
INEVLGDAIAWRTPPTTRQGRQGRIYYGTQVTTQPPSFTLFVNDPKLFGESYRRYIERQF
RESLGFSGTPIRLFWRGKKSRELERGANRATRV

BLAST