GenomeNet

>syc:syc1769_d no KO assigned | (GenBank) opcA; glucose 6-phosphate dehydrogenase assembly protein (A)
MTTATPLLSLQKPTPIALAEIEESLSQLWANQQHSGAGALVSRAATFSIVVYEPEEFQQI
LAALGLYHGHLDGLHGPMTRAAIAQAQTQFGLPSTGRPDSATFKALRQAYQALKHSPSLT
NQDLRGAVLSNVIATQNPCRIVSLCPTLEGDRPISAEVSAYCPITSAKQASLICCEAVTL
RGSQAEMEAIGTFVSELLLPGLPRYVWWKATPNPEQLLFQQLANSCNCMIFDSSYFSDPE
AEFLRFQDLIDQETYIADLNWHRLAAWQELTAAAFDPPERRDGLLEVDQLVIDYEKGNPA
QALMYMGWIASRLGWQPVSYRCEGGEYDLRQIEFRTEDDRMVKVELAGIPVGDPGLVLGD
LIALRLTSENPDADCCTILCSETTGCMRMEAGGGAQSCRTEQVAPPSNETSESLLAMQMQ
RWGRDALYEESLAVIAVALRQRTHA

BLAST