GenomeNet

>syc:syc1773_d K06885 uncharacterized protein | (GenBank) hypothetical protein (A)
MPSRRQRIYHDPLHGAIALQFEDPLEATLIRLIDTPPFQRLRRTCQLGPASLTFHGAEAS
RFTHSLGVMQVARRAFAPIAADWPELAVHRPALLCAALLHDLGHTAFSHTGEEIFHCQHE
QWTARLITEDSPIRRVLADYDPALPEQVLAVYRKQYQPLLISRLITSQLDCDRLDYLLRD
SYFTGASYGRLDLDRILSALRFDSESGELAVAEKGLAAIEHYLVVRSFMYSQVYNHPKNI
VAGWMLVRIFERARQLWQEQPRSLFVDPLLQPWFEQPVTDLSLEEYLAVDDIVCLYHLQR
WQDSADPLLADLCRRYRDRDLLKALNLRNLPAEQQQTLLEHSQQLIRNQGQDPTGYTGLC
QTQSRGYTLYQSGIRLATDQGLLEISQRSPLIRALLEPPSQAWLIYPRVIEQPLKQQWQL
VRGS

BLAST