GenomeNet

>syc:syc1774_c no KO assigned | (GenBank) hypothetical protein (A)
MSIPNGGSHQSLEALLAAYDFRLRHEPRNCTLWNNRGILLERLNRWTEALASYNCALEIT
PQRQEALNNRAIVLEHLGRLPEAVESYEQALAIDRQQPEVWNNRGIVLRKLGRLEDAIAS
YQQAIALAAHYAQAWANCGFALWQQGRYREAVRHYEQSVAIDPDQSSAWRQLGQIYLSVD
QPDQALRCLDQAIALQPQQATAWTWRGHALYNLGQYAAALTSYENAELLGDRPLLLSIQR
GHTLAQLERYEEALASYAAILPQLTGEAAAEVAYYQGLVWAYLQDWTAALAAFDQAIAGN
PDLAEAWYNRAALHARLDQPVAAIADLQQAIALDPDTYRSLAAEDPDYQTLHAHPDWIQL
QRA

BLAST