GenomeNet

>syc:syc1776_c K09797 uncharacterized protein | (GenBank) hypothetical protein (A)
MTETRHWAERLLHPHHFVVGLTILTLGLAWTGNTVVSNLRRGSDRLTVTGASTQRVTSDR
VTWRITVNRQAATLAAAYEALQPDLDRTVRFLEANGVQATEIQRGVINSFPIYQTLPNGT
NTNEVAAYRASQVLTIESKEVVRIQGLSQEIGQLLTEGVNLEIAPPAYTFSKLPEYRVEL
LAQATEDARKRAAAIAQQGGSQLAAIASAETGVFQITAPNSTDVGDGGSYDTSTIEKDMT
AVISVSFRLN

BLAST