GenomeNet

>syc:syc1784_c K09932 uncharacterized protein | (GenBank) hypothetical protein (A)
MNVNTARTSAVIVHPVPPAYADCYLVWQQSITTAAAQFDGYQGTDIYPPENDRDPNWIAV
LHFQTPADLQGWLDSPQRAEILAQLPPELAGYSKTVLPQGFAPWFSQLLHKPPSWKMALT
VLLALYPTVLLLNLLITPHLQGLGRAGAVLVGNAIGVALMQWGIMPRLTRLLKPWLSADS
DRRFSVLGGAAIVSILLLLAHLFQRWFF

BLAST