GenomeNet

>syc:syc1786_c K02114 F-type H+-transporting ATPase subunit epsilon | (GenBank) atpE; ATP synthase epsilon subunit (A)
MSLTVRVIAPDRTVWDAPAQEVILPSTTGQLGILPGHAPLLSALDTGVLRVRADKEWLAI
AVLGGFAEVENNEVTVLVNAAERGDKIDLEEARAAFSQADERLKGVKEDDRQGKFQATQA
YRRARARLQAAGGLVSV

BLAST